PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0149s0040.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 501aa    MW: 54388.8 Da    PI: 7.4517
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0149s0040.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.76.8e-40142202262
                  zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                             ++k+++cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk+ss
  SapurV1A.0149s0040.1.p 142 PDKIIPCPRCNSMDTKFCYYNNYNVNQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKSSS 202
                             7899******************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-31139199IPR003851Zinc finger, Dof-type
PfamPF027013.9E-32144200IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.789146200IPR003851Zinc finger, Dof-type
PROSITE patternPS013610148184IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 501 aa     Download sequence    Send to blast
MSDLAIKLFG KTIPLQLNQQ EDVSCAANKY ESSSGTPPGS EDCCDNTTTA TSSHENHRSH  60
KERREQEGNN RETSGEEIAN DKHEVVTSNQ INKDSKGPTS SGIKENPETT TSAERETSSL  120
KSSKNEEQSE TSISQEKTLK KPDKIIPCPR CNSMDTKFCY YNNYNVNQPR HFCKNCQRYW  180
TAGGTMRNVP VGAGRRKNKS SSASHYRHLM VSEALRTAQV HAMNGFHNPA LGNNSTVLTF  240
GSDSPLCESV ASVLNLSEKT QNSVRNGYHR PERRIIVSCG GTGGDGDDHS SVSSATASNS  300
SEKGCNGTSR EAVNKDYQSF PPQVPCFPGP PWPYPWNSAM SPPTVCPSGY PVSFYPAPTY  360
WGCAVPSPWN VPPCAYSPSA SLNHGIQSYS PTSPLGKHSR DGNILNPPCL EEPSRDGTKS  420
ETGVFVPKTL RIDDPSEAAK SSIWATLGIT SEKSNSINGG GLFKGFQSEK EDRNYMAGTA  480
SVMQANPAAF SRFLNFHENT *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006379668.10.0hypothetical protein POPTR_0008s08740g
TrEMBLU5G2270.0U5G227_POPTR; Uncharacterized protein
STRINGPOPTR_0008s08740.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62534147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.11e-73cycling DOF factor 3